SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|4653|gm1.2893_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|4653|gm1.2893_g
Domain Number 1 Region: 129-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-26
Family RecA protein-like (ATPase-domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily DNA primase core 0.00000288
Family Primase fragment of primase-helicase protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|4653|gm1.2893_g
Sequence length 387
Sequence
MAIYQSTNLPAVSLPRDIFQIPPESLILFSQFDKIYIWMDNTIQGQNASIQFARKLGLNR
CQLIKPTEHDQNPPFNALDAVYKKLNIQEWLDRSQPYTHQNILGFSALRDSVFMEVMNSE
QAKGVPSNDFPALSQIIKGLRPGELTIFSGPTGSGKTTFLSQISLDYCKSGVSTLWGSFE
INNVRLVKKMLYQYAGFSLQGDFEQYKEWAEKFNTLPLYFLKFFGTTPIHRVIEAMQHAV
EAYDVQHFIIDNLQFMTSGLGKGFEKWDIQDNALTQFRQFATNYNVHVTLVVHPKKDDRG
FLDINSVFGSAKVTQEADNVIFIQNGPNKLRFIDVKKNRFDGTVGMVPLKFDPESNRILQ
LNEEELNELKRYYADIGGKADRSQDLM
Download sequence
Identical sequences A0A137PC59
jgi|Conco1|4653|gm1.2893_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]