SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|85954|estExt_fgenesh1_pg.C_1220001 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|85954|estExt_fgenesh1_pg.C_1220001
Domain Number 1 Region: 445-503
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000000117
Family SPT5 KOW domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 155-237
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000085
Family N-utilization substance G protein NusG, N-terminal domain 0.0097
Further Details:      
 
Weak hits

Sequence:  jgi|Conco1|85954|estExt_fgenesh1_pg.C_1220001
Domain Number - Region: 238-281
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00946
Family Ribosomal proteins L24p and L21e 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|85954|estExt_fgenesh1_pg.C_1220001
Sequence length 1212
Sequence
MSKRRDDSDQERYDDEEEYDEEYDEEEYDEEEEEDDDYDSKPKKRAKKMSKKNMFIDDIA
VVDEDEEEEEYEEGLEDDFIDHANEISQSLSQASRSARLIHREDENENFMTPEQEAELLR
QKYGRHYNAMDGFGEQFDASQQSFLMPSVNDPTLFMIKCKPSKEYEVIMSLMKKYIGNES
GTEPLEIYSAYSRPSFPGYVYVEARKVTNVQKAAANINFLYGGKVTMVPINEMTDVLKIR
RKQASLSKGAWVRFRRGKYAGDIAEIMEVDESGEYAVVKIIPRLDLSNVGSAANRMTRPK
SESLGGLAKNRPSQKLFNKDEIVAISGTRSVSVRGKNLFLYNGDYFRNGFLEKEVKLSMF
ITEDVNPTLDEITKFANAVEDDHARAAILATASSSSNNNNNVTFDIGELVEVHDENSDPL
LGTISHIEGNSVKVIPRGSSHPLTFLKKQLRKRFKSGDHVQVMNGKYKGQSGLVNQVQLN
AVTFVSDSTSEEITVFPKDLAEATGTTAPATKPLHKFNLYDIVQLDGSDFGIVIKLDGDK
VRIMDQDANVRTVPQNLISSVRNSNRIVAVDKNNQPLQIGDPIREFDGARQEGSIVHIYK
NVVFVRSRNTMQNGGIFVSRTRNILNLAAKTNAPPKQSQGGFQAPQFKSDSNRPAGGDRQ
FQRPGGFGRRDQIISKTVTISNGPYKGYLGIVKDATPTSVRIELHTNSKVVTVERSIVKI
QGEESSQPPGSSWASNNNPRRTPSHFNSRSGSNAPQSVWNSSNRDYLSSSTPHYRPKSFD
SRSDVNNPGKSTPRHRNMFSSNDSTFNPSGPSTPSYSSSWASISGSNGAQDGWGQMGRGE
SDWAKSGAETPSNGGWGKSDSGSGWNEKASDSWSNSAEAGGWGSNNKPSSNWGQNDSSSS
WDASNERSSKNSSWGSPKSSSGWGSKSKDQSSSSSQSRDWKSDYGSKNDDSDKPSRSSAS
DSHSAFAQFDEPPSPMGAPTPMASHNSRNSNMESSTPFAAPTPFGMATPLGAPTPMGAPT
PLGAPTPLGAPTPMGAPTPLYYPTFVPQSAHSPPSLSGNRSPVYGESSSKPRAPCVDNKG
KYGKLDLVNRPLDTKWQASNIEISIVPNRKTNSSEFNGEHDHQRGVIKFVDAGSRKCTVE
LNSSGKQLSVPFEALEPSKPTRQDNIMILSGEVKGQKGTLIGYENDEAIVELNQYEGLRT
IDVYCVGKVVNN
Download sequence
Identical sequences A0A137P2P3
jgi|Conco1|85954|estExt_fgenesh1_pg.C_1220001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]