SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|5379|gm1.3619_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conco1|5379|gm1.3619_g
Domain Number - Region: 607-663,822-845,894-977,1380-1466,1534-1616,1916-1957
Classification Level Classification E-value
Superfamily ARM repeat 0.0107
Family GUN4-associated domain 0.06
Further Details:      
 
Domain Number - Region: 1695-1816
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz alpha-1 subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|5379|gm1.3619_g
Sequence length 2003
Sequence
MKNSTQRIFILALIQLLCIQANTQLQSKEVEKLANSIGRIDNCEVCTLSTTLDQPRLLVS
RATPYTSTSADNQAITLELTNDRKSDLRAVIDLIKEASKSSSHQIAELIDSFINKHYSND
YGTFSQLVQDVVDQIHNIVKSTNFDASDHVFKSLITKHLNDLEMAYFREKHAKDSVGVFK
AFEFSDNKQEDTKKLYESLKSINPFNIQDAVSFILNFIKKHYSSEKGNSGDMVLIIHRIV
SHVQSSQFEPANPGNQEKMNGWFLQLENAKKDAENQPIKFTPYKIPSVSDDRASSHDSII
KSVPSVNSQNQVDFVAFIVKYLNEQYSGDKMPFDIRSHNTILQFIDYVSSENFEPNSEIT
INQIRFFFDQLDRVYDELKDPNAKNNGFPELKWTSNKEEDRKKLLEASKTISNRNRKTAS
NAYFSYMDTYYTKEDKTFDSQIQRIVISIVNMINNPEFKGSDEKCINNIAQELDQLDYKA
SLVEKDSKNNKFIRPNLSGVKEDDKEKIFQSIKLMKSSDKQQVKDLFWDFILLYYGYAGG
ELNSSLTPIASEIFKTIDSPYFRPLKTDTLNNLIDKLDKKKESIDKMDTTSNTYTPPEPS
EDKFAYIEELLDSMKQINNKNRNDVYRTFKQCLLKFYGNPDGTLPNSIKSTSNEILDMIK
SSDMNPNDQYNLDKIKQLFSLLDKSMKYANGNQAPSVYIQPEFTKNKESDTDKLVASLKN
VNQANAQLVYESITNFIDLYYLDSNGQYSISVGDYVAELVNYILSQDFDPYSNYSQEVRN
KINRIDAAFQETQKQEKSDGYQAPPISNNPKEDKKKFIESIENITPSTVERALIFLDKYF
EKNYSGPNMSIHPSIQAKISGLKNILTARDFNPKDSITKLKVENALNGIERIYHNLENPA
PTAFSKIKLEGDKEKDLKEAIKLLGSITKENQKAAEEFYDRLLRQYFGLESGGYDTRIFS
KVYEILSSIRSLNFKQNNTESIQKIRDLILKLDKTATESKVSHVNPVYIPPDLTEVREVD
WNNFLESLKYLNKHTKEGAIKYGKTLLDMYYRKSDGSMDFKFTSLIFDFLEKLRSKDFDK
AGDIDIEDLKQMILEMDKIQADITEGNEIDNLKSYLFTGSKIRDFSYFLRMIQYITKAHI
EDASTFLHKYISYYYGKKDGSLDISIYIQASNMQQYLKSSEFDPKKKATVAKFRQLNTEL
EQVFSKALNNSNISPPFSQPMLTGNSTIDRHNTIDALSSTNRGNRIDAINFIRKFLLADF
GSKNGGFDVEYVTIVSEINNLLDQPSTDLSDSKTQVKLDGLFIKMEEASNLKEERNIATH
YKSPTLTSDHSTNIIEIGKSFENASDINQEEISNFIVDFVNQAFFSIDEILDLEIRSLKN
QLISLIRQRNFSYKNQDHANRVIYQLNQINRKYQTLQKAQNAAPYIRPTFTDNRQENRAR
LLDSFKGIEQNSKNKDSMIRAVEEFIKISYEKENTSHGFMIAPKKQEVLRAIKKDSFYFT
DINGCIELKRLLNELEVAYNTSQTLSISKPYSPPKLTNNSTKDFDSIIKSFDQVTKDNIP
EVKSTIYEAMKKHFGDPQGELSIEMSSIESKIYNLIGTQGINLKDPIVIQKIWGYLKDAE
MLKIKENTPQAPKDKFTPPGFTNNTEKDFEILVEILKKQGNTGDIDVQKYTDSFLKHHYQ
TNSNGKWEEILLVLYNQATSLIASKNFDLNNKKIFDEFKYIISKLNYETDNIRNAPPLPK
SYVAPTLTGKKAEDLDNLINSLNQTTQFSRNDIVDAFKKYINVNYENDKNIVALVYDKKT
EIITFISSPKNNLQSYSVQKAIRNEFKTLDIKINEYYKNKPPPYKAPDLTENPNNDLINL
MMSFSRVTKDSDTDAQNAVVNYMNKHFGGGKESYPSELKGIVDGITNMITSTTPKFSFAD
DKNKELLQNALFELKNLYAKVEASKPICKDFAPPVLDYDNRDDSTKKMVLSLNQVTPCNK
YQALKFFRTEYLEKFYYENDNSV
Download sequence
Identical sequences A0A137PA23
jgi|Conco1|5379|gm1.3619_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]