SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|78354|fgenesh1_kg.58_#_35_#_Locus5221v1rpkm8.44 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|78354|fgenesh1_kg.58_#_35_#_Locus5221v1rpkm8.44
Domain Number 1 Region: 16-174,238-289
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-35
Family Kelch motif 0.032
Further Details:      
 
Domain Number 2 Region: 364-476
Classification Level Classification E-value
Superfamily POZ domain 0.00000314
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|78354|fgenesh1_kg.58_#_35_#_Locus5221v1rpkm8.44
Sequence length 679
Sequence
MTVALFSEATVSTSLTLGTVPSARVGPSLASNGNKIYVFGGRQMNSRTVTNDLYCFDLTT
MIWEQLTYSGEIIPPPRYFHSSCVYKDDYFIVTGGQGYQGNGEQSSVSIFNDICILDLKT
KTWEIINLDLEKIPARYAHLTSIIDDKLIIVGGQDLNNEYLLDVQIFSLTTKKIHLSQAI
GNSFGAYRSTLSVKKGAEPTLKIFSNSRFSDVNREFITIQSDFQTSSNFNIQEHCLSTNS
RDLPPGLRFPEGYIINNQMVISGTYLSNNTQSYNLWSLNMDTLEWRRIDTGSSFARGSWN
RGILDPLRNRFIVFGHRDRDLVQDYNQRRINFTNISIVDLESFNIYREPEFCNDDQAQEL
GLMMMYEPRFSNFSLLTKDDFRIHINSAFLRSRWPSFDVFLVHTQSKDRDNKLQGPPNTL
YLQESYRVVQAFVRYLYTNALDPEMIDDIDQLGRLLVFAHYYSVDHLYSLVAARLHTCLD
IKNAPQIFRYSSMAARNGLKLRSLSLMIQERRFLVNDMDFWQTYPEQFREEIIRYMPPNF
QYPHPLPAAAPSSQSTNSTVKSSSASIRTNSETASQSYFMQEASNRTSVNSTTPLNLEDA
ISPLPPKKNRSNSSFLKFGFRRPSVANLFNFSSPSQPQTPTSSTPESLGPSNGAGVPDII
ANIDAQLNGTSTKSSAADK
Download sequence
Identical sequences A0A137P8X7
jgi|Conco1|78354|fgenesh1_kg.58_#_35_#_Locus5221v1rpkm8.44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]