SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|52842557|ref|YP_096356.1| from Legionella pneumophila subsp. pneumophila str. Philadelphia 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52842557|ref|YP_096356.1|
Domain Number 1 Region: 10-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.33e-106
Family FMN-linked oxidoreductases 0.00000000497
Further Details:      
 
Domain Number 2 Region: 339-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.77e-39
Family N-terminal domain of adrenodoxin reductase-like 0.0000155
Further Details:      
 
Domain Number 3 Region: 475-629
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.05e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52842557|ref|YP_096356.1|
Sequence length 674
Comment 2,4-dienoyl-CoA reductase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Sequence
MELRIDNTPFKAIFQPLDLGFTQIKNRLLMGSMHTGLEEDKENLNRLASFYRERAQGGVG
LIVTGGFAPNRAGRLAPFAAKLTNSKEQHRHEVITQAVHEAGGKIALQILHAGRYGYHPF
IVAPSGIKSPISPFKPWEMSKRRIIKTIKHFARCARLAQLAGYDGVEIMGSEGYLINQFI
VTHTNHRRDEWGGSFSNRIRFPIEIVRSVREAVGEHFIIIYRLSMLDLVAEGSNWQEVVT
LAKAIEQAGASLINTGIGWHEARIPTIGTMVPSAAFTPVTQHLKPEIKIPVITSNRINTP
ELANQLLEDGVADMISMARPFLADPCFAEKAKLGESKAINVCIACNQACLDQVFVNKTAS
CLVNPRACNETTLVYETTNQPKAIAVVGSGPAGLAFAVTAAERGHKITLFEKANQIGGQF
NLAKKIPGKEEFQHTLNYFAYQLQKYKVDVRLNTEATVELLKDYDEVVLASGIIPRVPEI
KGIDHKKVVSYIDVITQNKPVGSRVAVIGAGGIGFDVAEFLTHDHQLTSEQFYNEWGIDI
SGQHRGGLKPPEIAPSPREVYLLQRKKEKMGKRLGKTTGWIHRSSLKHKQVKMLSGVNYE
RIDDQGLHLTIDDKPQVLEVDSIVICAGQIELKNLYEPLKMAGKLVHLIGGAYKALELDA
RHAIDQACRLAALV
Download sequence
Identical sequences A0A2J9NGV1 G8UU06 Q5ZT18
272624.lpg2347 gi|378778245|ref|YP_005186684.1| gi|470181408|ref|YP_007567283.1| gi|509151693|ref|YP_008064067.1| WP_010948053.1.100881 WP_010948053.1.101385 WP_010948053.1.10160 WP_010948053.1.11666 WP_010948053.1.1188 WP_010948053.1.12035 WP_010948053.1.12661 WP_010948053.1.14235 WP_010948053.1.15016 WP_010948053.1.16078 WP_010948053.1.16593 WP_010948053.1.16748 WP_010948053.1.16962 WP_010948053.1.17857 WP_010948053.1.19321 WP_010948053.1.19554 WP_010948053.1.20369 WP_010948053.1.2062 WP_010948053.1.2085 WP_010948053.1.21466 WP_010948053.1.21493 WP_010948053.1.21924 WP_010948053.1.22734 WP_010948053.1.22766 WP_010948053.1.2333 WP_010948053.1.23459 WP_010948053.1.24053 WP_010948053.1.24333 WP_010948053.1.2441 WP_010948053.1.24636 WP_010948053.1.26718 WP_010948053.1.27038 WP_010948053.1.27501 WP_010948053.1.27674 WP_010948053.1.28814 WP_010948053.1.29318 WP_010948053.1.29802 WP_010948053.1.30583 WP_010948053.1.30653 WP_010948053.1.30822 WP_010948053.1.31291 WP_010948053.1.32608 WP_010948053.1.32615 WP_010948053.1.32659 WP_010948053.1.33479 WP_010948053.1.33708 WP_010948053.1.35118 WP_010948053.1.35787 WP_010948053.1.36420 WP_010948053.1.37108 WP_010948053.1.37274 WP_010948053.1.37932 WP_010948053.1.3819 WP_010948053.1.38679 WP_010948053.1.40870 WP_010948053.1.41185 WP_010948053.1.41378 WP_010948053.1.41486 WP_010948053.1.44619 WP_010948053.1.44866 WP_010948053.1.45024 WP_010948053.1.46042 WP_010948053.1.46096 WP_010948053.1.47823 WP_010948053.1.47956 WP_010948053.1.48346 WP_010948053.1.51153 WP_010948053.1.51428 WP_010948053.1.51956 WP_010948053.1.52283 WP_010948053.1.52706 WP_010948053.1.52905 WP_010948053.1.53250 WP_010948053.1.53261 WP_010948053.1.53669 WP_010948053.1.53795 WP_010948053.1.53844 WP_010948053.1.54355 WP_010948053.1.57055 WP_010948053.1.57468 WP_010948053.1.58541 WP_010948053.1.58606 WP_010948053.1.58931 WP_010948053.1.59227 WP_010948053.1.59576 WP_010948053.1.60239 WP_010948053.1.60770 WP_010948053.1.61895 WP_010948053.1.62077 WP_010948053.1.63282 WP_010948053.1.636 WP_010948053.1.64335 WP_010948053.1.64388 WP_010948053.1.64512 WP_010948053.1.64856 WP_010948053.1.66209 WP_010948053.1.66299 WP_010948053.1.68412 WP_010948053.1.68702 WP_010948053.1.69197 WP_010948053.1.70346 WP_010948053.1.70691 WP_010948053.1.7124 WP_010948053.1.71556 WP_010948053.1.73029 WP_010948053.1.73915 WP_010948053.1.74438 WP_010948053.1.75353 WP_010948053.1.75911 WP_010948053.1.76298 WP_010948053.1.76893 WP_010948053.1.77472 WP_010948053.1.77852 WP_010948053.1.77866 WP_010948053.1.79027 WP_010948053.1.79030 WP_010948053.1.79957 WP_010948053.1.80678 WP_010948053.1.80733 WP_010948053.1.80817 WP_010948053.1.81970 WP_010948053.1.82765 WP_010948053.1.83499 WP_010948053.1.8363 WP_010948053.1.84081 WP_010948053.1.85699 WP_010948053.1.86349 WP_010948053.1.86607 WP_010948053.1.87629 WP_010948053.1.87656 WP_010948053.1.88081 WP_010948053.1.89135 WP_010948053.1.89155 WP_010948053.1.89171 WP_010948053.1.90392 WP_010948053.1.90650 WP_010948053.1.91256 WP_010948053.1.91480 WP_010948053.1.93200 WP_010948053.1.94508 WP_010948053.1.9567 WP_010948053.1.96018 WP_010948053.1.96198 WP_010948053.1.97598 WP_010948053.1.97635 WP_010948053.1.98470 WP_010948053.1.98928 YP_096356.1.86292 gi|52842557|ref|YP_096356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]