SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|52843125|ref|YP_096924.1| from Legionella pneumophila subsp. pneumophila str. Philadelphia 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52843125|ref|YP_096924.1|
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily YccV-like 9.94e-25
Family YccV-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|52843125|ref|YP_096924.1|
Sequence length 107
Comment hypothetical protein lpg2931 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Sequence
MEPFMNKIAKYNIGDLVIHKRIRYRAIVIDVDPIFQASGKYNPRATQHEFATRNPWYRLL
VDDSSQITYVEECQLLPDTSQEPINNPNIDDYLIKNKGSYQKTIPSH
Download sequence
Identical sequences A0A2J9NFB6 G8UVW0 Q5ZRF1
gi|378778811|ref|YP_005187253.1| gi|52843125|ref|YP_096924.1| 272624.lpg2931 WP_010948616.1.100881 WP_010948616.1.101385 WP_010948616.1.10160 WP_010948616.1.101751 WP_010948616.1.101869 WP_010948616.1.10234 WP_010948616.1.11317 WP_010948616.1.11666 WP_010948616.1.1188 WP_010948616.1.12035 WP_010948616.1.1206 WP_010948616.1.12661 WP_010948616.1.13961 WP_010948616.1.14235 WP_010948616.1.14270 WP_010948616.1.14396 WP_010948616.1.15016 WP_010948616.1.16078 WP_010948616.1.16593 WP_010948616.1.16601 WP_010948616.1.16748 WP_010948616.1.16962 WP_010948616.1.17351 WP_010948616.1.17430 WP_010948616.1.17857 WP_010948616.1.18568 WP_010948616.1.19186 WP_010948616.1.19321 WP_010948616.1.19554 WP_010948616.1.20369 WP_010948616.1.2062 WP_010948616.1.2085 WP_010948616.1.20993 WP_010948616.1.21466 WP_010948616.1.21493 WP_010948616.1.21924 WP_010948616.1.22039 WP_010948616.1.2239 WP_010948616.1.22734 WP_010948616.1.22766 WP_010948616.1.2333 WP_010948616.1.23459 WP_010948616.1.2394 WP_010948616.1.24053 WP_010948616.1.24333 WP_010948616.1.2441 WP_010948616.1.24636 WP_010948616.1.24790 WP_010948616.1.24881 WP_010948616.1.2526 WP_010948616.1.25566 WP_010948616.1.26718 WP_010948616.1.27038 WP_010948616.1.27354 WP_010948616.1.27501 WP_010948616.1.27674 WP_010948616.1.28020 WP_010948616.1.28346 WP_010948616.1.28814 WP_010948616.1.29318 WP_010948616.1.29802 WP_010948616.1.29930 WP_010948616.1.30513 WP_010948616.1.30578 WP_010948616.1.30583 WP_010948616.1.30653 WP_010948616.1.30717 WP_010948616.1.30822 WP_010948616.1.31291 WP_010948616.1.31862 WP_010948616.1.32608 WP_010948616.1.32615 WP_010948616.1.32659 WP_010948616.1.33479 WP_010948616.1.3365 WP_010948616.1.33708 WP_010948616.1.34228 WP_010948616.1.35118 WP_010948616.1.35787 WP_010948616.1.36420 WP_010948616.1.36556 WP_010948616.1.36852 WP_010948616.1.37108 WP_010948616.1.37274 WP_010948616.1.37792 WP_010948616.1.37932 WP_010948616.1.38174 WP_010948616.1.3819 WP_010948616.1.38634 WP_010948616.1.38679 WP_010948616.1.38919 WP_010948616.1.3933 WP_010948616.1.40024 WP_010948616.1.40375 WP_010948616.1.40870 WP_010948616.1.41061 WP_010948616.1.41185 WP_010948616.1.41194 WP_010948616.1.41378 WP_010948616.1.41486 WP_010948616.1.42405 WP_010948616.1.43838 WP_010948616.1.44619 WP_010948616.1.44696 WP_010948616.1.44866 WP_010948616.1.45024 WP_010948616.1.46042 WP_010948616.1.46096 WP_010948616.1.47341 WP_010948616.1.47557 WP_010948616.1.47823 WP_010948616.1.47956 WP_010948616.1.48346 WP_010948616.1.48881 WP_010948616.1.50772 WP_010948616.1.51024 WP_010948616.1.51153 WP_010948616.1.51257 WP_010948616.1.51428 WP_010948616.1.51685 WP_010948616.1.51956 WP_010948616.1.51958 WP_010948616.1.52283 WP_010948616.1.5252 WP_010948616.1.5268 WP_010948616.1.52706 WP_010948616.1.52723 WP_010948616.1.52787 WP_010948616.1.52905 WP_010948616.1.53250 WP_010948616.1.53261 WP_010948616.1.53474 WP_010948616.1.53602 WP_010948616.1.53669 WP_010948616.1.53795 WP_010948616.1.53844 WP_010948616.1.54355 WP_010948616.1.547 WP_010948616.1.54704 WP_010948616.1.54834 WP_010948616.1.56486 WP_010948616.1.5660 WP_010948616.1.57055 WP_010948616.1.57468 WP_010948616.1.57482 WP_010948616.1.58541 WP_010948616.1.58606 WP_010948616.1.58658 WP_010948616.1.58764 WP_010948616.1.58931 WP_010948616.1.59227 WP_010948616.1.59576 WP_010948616.1.59692 WP_010948616.1.60120 WP_010948616.1.60239 WP_010948616.1.60770 WP_010948616.1.61227 WP_010948616.1.61570 WP_010948616.1.61895 WP_010948616.1.62077 WP_010948616.1.62869 WP_010948616.1.63282 WP_010948616.1.636 WP_010948616.1.64049 WP_010948616.1.64298 WP_010948616.1.64335 WP_010948616.1.64388 WP_010948616.1.64512 WP_010948616.1.64856 WP_010948616.1.66058 WP_010948616.1.66209 WP_010948616.1.66299 WP_010948616.1.67448 WP_010948616.1.67763 WP_010948616.1.68151 WP_010948616.1.68412 WP_010948616.1.68702 WP_010948616.1.69197 WP_010948616.1.69332 WP_010948616.1.70346 WP_010948616.1.70654 WP_010948616.1.7066 WP_010948616.1.70691 WP_010948616.1.70860 WP_010948616.1.7124 WP_010948616.1.71556 WP_010948616.1.7196 WP_010948616.1.72375 WP_010948616.1.73029 WP_010948616.1.73915 WP_010948616.1.74003 WP_010948616.1.74371 WP_010948616.1.74412 WP_010948616.1.74438 WP_010948616.1.7452 WP_010948616.1.75242 WP_010948616.1.75353 WP_010948616.1.75911 WP_010948616.1.7619 WP_010948616.1.76298 WP_010948616.1.76893 WP_010948616.1.77472 WP_010948616.1.77829 WP_010948616.1.77852 WP_010948616.1.77866 WP_010948616.1.78342 WP_010948616.1.79027 WP_010948616.1.79030 WP_010948616.1.79998 WP_010948616.1.80041 WP_010948616.1.80459 WP_010948616.1.80678 WP_010948616.1.80733 WP_010948616.1.80817 WP_010948616.1.81762 WP_010948616.1.81970 WP_010948616.1.82765 WP_010948616.1.83017 WP_010948616.1.83062 WP_010948616.1.83499 WP_010948616.1.8363 WP_010948616.1.83658 WP_010948616.1.84081 WP_010948616.1.84341 WP_010948616.1.85643 WP_010948616.1.85655 WP_010948616.1.85699 WP_010948616.1.85818 WP_010948616.1.86050 WP_010948616.1.86349 WP_010948616.1.86607 WP_010948616.1.87014 WP_010948616.1.87225 WP_010948616.1.87431 WP_010948616.1.87629 WP_010948616.1.87656 WP_010948616.1.87917 WP_010948616.1.88023 WP_010948616.1.88081 WP_010948616.1.88271 WP_010948616.1.88601 WP_010948616.1.89135 WP_010948616.1.89155 WP_010948616.1.89171 WP_010948616.1.90392 WP_010948616.1.90650 WP_010948616.1.90915 WP_010948616.1.91256 WP_010948616.1.91480 WP_010948616.1.92683 WP_010948616.1.93162 WP_010948616.1.93200 WP_010948616.1.93993 WP_010948616.1.94044 WP_010948616.1.9449 WP_010948616.1.94508 WP_010948616.1.94611 WP_010948616.1.9567 WP_010948616.1.9568 WP_010948616.1.96018 WP_010948616.1.96198 WP_010948616.1.96522 WP_010948616.1.97528 WP_010948616.1.97598 WP_010948616.1.97635 WP_010948616.1.97638 WP_010948616.1.97957 WP_010948616.1.9807 WP_010948616.1.98134 WP_010948616.1.98163 WP_010948616.1.98470 WP_010948616.1.98839 WP_010948616.1.98928 WP_010948616.1.99514 WP_010948616.1.9953 WP_010948616.1.9970 WP_010948616.1.99870 YP_096924.1.86292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]