SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|52842382|ref|YP_096181.1| from Legionella pneumophila subsp. pneumophila str. Philadelphia 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52842382|ref|YP_096181.1|
Domain Number 1 Region: 151-249
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.15e-16
Family N-acetyl transferase, NAT 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|52842382|ref|YP_096181.1|
Sequence length 257
Comment acetyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Sequence
MNSRIETFHQMEWHFFSLISMELLSLEGLKACNSGMPIPALNPVFYSGKSTLLVAEIYQC
KRFYESHSVPWALMVPDYLSDTKTDNVLAQSGFLSIDQGVAMYLSIQDLGMPGFKSDLLI
KRMDNEMETWILPTIPAFESTAEIAKIYRVRHQEAIEKSSDIYHFSGFIQEQIVCSLTLT
VMGDCARIDDVATFPKYQKNGYATQLILSELQILKDTNISWCFLEASADGLNIYKKIGFR
ELFKNLYYEEQYHYEQN
Download sequence
Identical sequences A0A2J9NHD6 G8UYF1 Q5ZTJ3
gi|470181598|ref|YP_007567473.1| 272624.lpg2168 APC60749 gi|52842382|ref|YP_096181.1| gi|378778070|ref|YP_005186508.1| gi|509150137|ref|YP_008062511.1| WP_010947879.1.100881 WP_010947879.1.101385 WP_010947879.1.10160 WP_010947879.1.11666 WP_010947879.1.1188 WP_010947879.1.12035 WP_010947879.1.14235 WP_010947879.1.15016 WP_010947879.1.16078 WP_010947879.1.16593 WP_010947879.1.16748 WP_010947879.1.16962 WP_010947879.1.17857 WP_010947879.1.19554 WP_010947879.1.20369 WP_010947879.1.2085 WP_010947879.1.21466 WP_010947879.1.21493 WP_010947879.1.21924 WP_010947879.1.22734 WP_010947879.1.22766 WP_010947879.1.2333 WP_010947879.1.23459 WP_010947879.1.24053 WP_010947879.1.24333 WP_010947879.1.2441 WP_010947879.1.24636 WP_010947879.1.26718 WP_010947879.1.27038 WP_010947879.1.27501 WP_010947879.1.27674 WP_010947879.1.28814 WP_010947879.1.29318 WP_010947879.1.29802 WP_010947879.1.30583 WP_010947879.1.30653 WP_010947879.1.30822 WP_010947879.1.31291 WP_010947879.1.32608 WP_010947879.1.32615 WP_010947879.1.32659 WP_010947879.1.33479 WP_010947879.1.33708 WP_010947879.1.35118 WP_010947879.1.35787 WP_010947879.1.36420 WP_010947879.1.37108 WP_010947879.1.37274 WP_010947879.1.37932 WP_010947879.1.3819 WP_010947879.1.38679 WP_010947879.1.40870 WP_010947879.1.41185 WP_010947879.1.41378 WP_010947879.1.41486 WP_010947879.1.44619 WP_010947879.1.44866 WP_010947879.1.45024 WP_010947879.1.46042 WP_010947879.1.47823 WP_010947879.1.47956 WP_010947879.1.48346 WP_010947879.1.51153 WP_010947879.1.51428 WP_010947879.1.51956 WP_010947879.1.52283 WP_010947879.1.52706 WP_010947879.1.52905 WP_010947879.1.53261 WP_010947879.1.53669 WP_010947879.1.53795 WP_010947879.1.53844 WP_010947879.1.54355 WP_010947879.1.57055 WP_010947879.1.57468 WP_010947879.1.58541 WP_010947879.1.58606 WP_010947879.1.58931 WP_010947879.1.59227 WP_010947879.1.59576 WP_010947879.1.60770 WP_010947879.1.61895 WP_010947879.1.62077 WP_010947879.1.63282 WP_010947879.1.636 WP_010947879.1.64335 WP_010947879.1.64388 WP_010947879.1.64512 WP_010947879.1.64856 WP_010947879.1.66209 WP_010947879.1.66299 WP_010947879.1.68702 WP_010947879.1.69197 WP_010947879.1.70346 WP_010947879.1.71556 WP_010947879.1.73029 WP_010947879.1.73915 WP_010947879.1.74438 WP_010947879.1.75353 WP_010947879.1.75911 WP_010947879.1.76298 WP_010947879.1.76893 WP_010947879.1.77472 WP_010947879.1.77866 WP_010947879.1.79027 WP_010947879.1.79030 WP_010947879.1.79957 WP_010947879.1.80678 WP_010947879.1.80817 WP_010947879.1.81970 WP_010947879.1.82765 WP_010947879.1.83499 WP_010947879.1.8363 WP_010947879.1.84081 WP_010947879.1.85699 WP_010947879.1.86349 WP_010947879.1.86607 WP_010947879.1.87629 WP_010947879.1.87656 WP_010947879.1.88081 WP_010947879.1.89155 WP_010947879.1.89171 WP_010947879.1.90392 WP_010947879.1.90650 WP_010947879.1.91256 WP_010947879.1.91480 WP_010947879.1.93200 WP_010947879.1.94508 WP_010947879.1.9567 WP_010947879.1.96018 WP_010947879.1.96198 WP_010947879.1.97528 WP_010947879.1.97598 WP_010947879.1.97635 WP_010947879.1.98470 WP_010947879.1.98928 YP_096181.1.86292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]