SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54020644|ref|YP_116171.1| from Mycoplasma hyopneumoniae 232

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54020644|ref|YP_116171.1|
Domain Number 1 Region: 200-322
Classification Level Classification E-value
Superfamily CBS-domain pair 1.13e-18
Family CBS-domain pair 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54020644|ref|YP_116171.1|
Sequence length 410
Comment hemolysin [Mycoplasma hyopneumoniae 232]
Sequence
MALYFAILSVVLVILFFISAIFSASETVFTATSRVKVDENIADSFWGKKQILRYYDNYEK
TLTIILIWNNIVNIGISIIISTFFSSLPINESLQILISIAATTPPLIIFGEIYPKIFGRK
KPILFLKYFWFFIGFFYYFLYPLATLMTKFVKKINVTNTENELKKIILQAQREEVLEKEE
SDLAIRALDFDSFKTAKHFTKLKDLVYVNYEDSLESIKNVIIDHNFSRIPVWKENNFIGI
LLSKDILYLDKFDINDHIVETPLLLATNLIKTNYEILKKAKSHLGFVIDNVENKKIIGIL
TFEDILECLFGPIYDEYDYRDDLDFYQINPNQITTKAETNIVTINKALKVDLPVSFKDLN
QWLLAQKPKKKLILGDKIYFRSPLYSLEFEIISKNANNIEVKITKNENQV
Download sequence
Identical sequences A0A223M8Z1 E4QTU9 Q4A784 Q4A945 Q5ZZP4 S5FYA9
gi|385334801|ref|YP_005888748.1| gi|54020644|ref|YP_116171.1| WP_011206494.1.100269 WP_011206494.1.25027 WP_011206494.1.28423 WP_011206494.1.35737 WP_011206494.1.4867 WP_011206494.1.51147 WP_011206494.1.62369 WP_011206494.1.76180 gi|72080970|ref|YP_288028.1| 262719.MHJ_0643 262722.MHP7448_0643 295358.mhp663 gi|525903805|ref|YP_008292048.1| gi|71893991|ref|YP_279437.1| gi|507383060|ref|YP_008026062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]