SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529055070|ref|YP_008370659.1| from Corynebacterium maris DSM 45190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529055070|ref|YP_008370659.1|
Domain Number 1 Region: 59-318
Classification Level Classification E-value
Superfamily SIS domain 1.49e-25
Family mono-SIS domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529055070|ref|YP_008370659.1|
Sequence length 326
Comment hypothetical protein B841_03445 [Corynebacterium maris DSM 45190]
Sequence
MNDYYDGSRYDPETVRFFDVAHEGAQVRAVSGVVDRLAELRGRQPRSIVVVATDHIALAS
ARFAAATRAPLRMPLVVCDRMPGYIGPLDVVLAVGDRADDPITAQALITAANRGATTIFV
GPPSGPILEDLPDDCLVVPALPTAAGASPARSITAVCTLLDALEEDPRLIAERLTKLAED
IDDEAAQLSPERGEVVNLGRQLHAWADGARVVHTGVDRGWTAVAELVSALWSSRGLASGW
TTPEELPVALRDVPAQSDIFHDPFLDGPFAVLPLKVIVWGAETTDLANATAVAAPASGLG
RLGQVHRLITRGFAVTTYNGSEDDAL
Download sequence
Identical sequences S5SSZ7
WP_020934105.1.48102 gi|529055070|ref|YP_008370659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]