SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375129702|ref|YP_004991800.1| from Vibrio furnissii NCTC 11218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375129702|ref|YP_004991800.1|
Domain Number 1 Region: 21-293
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1e-95
Family Methylenetetrahydrofolate reductase 0.000000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375129702|ref|YP_004991800.1|
Sequence length 295
Comment 5,10-methylenetetrahydrofolate reductase [Vibrio furnissii NCTC 11218]
Sequence
MGYTHASHIDALNQNIADLSDINVSFEFFPPSTAQMEETLWNSVHRLKTLKPKFVSVTYG
ANSGERDRTHSIIKAIKDQTGLIAAPHLTCIDASREELIQIADDYWHNGIQNIVALRGDI
PPGGGKPDMYASDLVTLLKSRHDFDISVAAFPEVHPEAKSAQADLLNLRRKVDAGANRAI
TQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVSNFKQASRFAAQNHVKVPSWMAKQFDG
LDDDPVTRQLVGASQAIDMVRILSREGVKDFHFYTLNRAEMTYALCHTLGVRPSL
Download sequence
Identical sequences A0A0Q2MEY6 F0LRT2
gi|375129702|ref|YP_004991800.1| WP_004728518.1.30636 WP_004728518.1.38130 WP_004728518.1.84411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]