SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375131608|ref|YP_004993708.1| from Vibrio furnissii NCTC 11218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375131608|ref|YP_004993708.1|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.27e-55
Family Molybdopterin synthase subunit MoaE 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375131608|ref|YP_004993708.1|
Sequence length 151
Comment Molybdenum cofactor biosynthesis protein E [Vibrio furnissii NCTC 11218]
Sequence
MDNRVSVQTQDFSVADEYAQLSAGTQAGAVVTFVGKVRDMNLGDNVTGLHLEHYPGMTEK
ALLEICDEAARRWPLQNVRVIHRVGDMDIGDQIVFVGVSSAHRSASFEACEFVMDYLKTK
APFWKKERTTEATRWVDSRESDAKAAERWQQ
Download sequence
Identical sequences F0LVA7
gi|375131608|ref|YP_004993708.1| WP_014205521.1.38130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]