SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375133068|ref|YP_005049476.1| from Vibrio furnissii NCTC 11218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375133068|ref|YP_005049476.1|
Domain Number 1 Region: 20-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-21
Family MarR-like transcriptional regulators 0.031
Further Details:      
 
Domain Number 2 Region: 153-288
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000284
Family N-acetyl transferase, NAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375133068|ref|YP_005049476.1|
Sequence length 296
Comment MarR-family transcriptional regulator [Vibrio furnissii NCTC 11218]
Sequence
MASVEQIRSELRYLVRELGLLDKNCWNSGLSLSQAHLLTYLSNNGATPFSELCIQLNADK
ASLSRTINKLVENGDVQPIPHPHDKRQKYYQLTLAGNETLQRANHAANHALGDVIDSLAE
DAQAAVLHGLRTLRLSAFHYNTRHQQARVQVEALNPVYRAEVEQLVMDVFAQEQNIPPAL
IPFAKDSDVQWWVARSGEYILGAVAAWREGDAWHWGRFAVNHQFRGLGIGKSLALTSLTE
LLATTPEILIEARDTTVNIVRQLGGEVLGDAFDFYGMPVTPMRLTATRFRATQQPM
Download sequence
Identical sequences F0LZ07
gi|375133068|ref|YP_005049476.1| WP_014257847.1.38130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]