SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375133264|ref|YP_005049672.1| from Vibrio furnissii NCTC 11218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375133264|ref|YP_005049672.1|
Domain Number 1 Region: 437-527
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375133264|ref|YP_005049672.1|
Sequence length 579
Comment sulfate permease [Vibrio furnissii NCTC 11218]
Sequence
MPGLYQFKHYERAWLVDDVRAAFSVVAVALPVAIAYAQLTGVSAIVGLYSCVAPMLVYAL
FGTSRQLIVGPDAATCAVVAAVVAPLAAGDPTKHWQLVMTMTAMMGIWCILASKFRLGIL
ADFLSRPILMGLLNGVALTIIVGQLSKVFGVKYEQSYLLERLAEAPQRLFDVHWQTVVVS
VLTVAVYFASKRFRPSWPAAMLAIISAGILVWATQLDSQGVNVVGLIQGGLPAFQTPTFD
IGISRELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGIANLASAFSQGFA
ISGADSRTAVNDANGGKSQLVSVIAAVVIGLVAIFLYRPLQYIPTAALGVVLIIASTSLL
DLKGLWGLRKRDKDAFYLASVTFIAVLIVGVIPGITLAVLLGLFQFLRVVMRPSDQRLGL
DKDGTIRTVDGTGKATPIPGLMLYRFNSPLTYFNAPYFKRRLLELVETSDSSVDCVVIDA
VASFTHLDLSVMAMLADVQNILKKRGIRLILAGRKRSMRQWCELSGVPVGDGGLVLRADM
YLAIKLSGCYQQAVEEGQVPPVQKEPEADALPKPVPEVA
Download sequence
Identical sequences F0LZK3
WP_014257985.1.38130 gi|375133264|ref|YP_005049672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]