SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|545629681|ref|YP_008580255.1| from Leifsonia xyli subsp. cynodontis DSM 46306

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|545629681|ref|YP_008580255.1|
Domain Number 1 Region: 110-325
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 6.28e-53
Family MurCDEF 0.0000803
Further Details:      
 
Domain Number 2 Region: 331-465
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 6.78e-32
Family MurCDEF C-terminal domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1-100
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.7e-21
Family MurE/MurF N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|545629681|ref|YP_008580255.1|
Sequence length 475
Comment UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-alanyl ligase [Leifsonia xyli subsp. cynodontis DSM 46306]
Sequence
MIALTLAEIAAATGGRLLLGSTDATPCTVVDGLSTTDSREVVPGAIFFAKPGEATDGHLF
VPQALEAGAALVVVDRELDVAGPQLVVEDTVVALGDLATEVIARVRALGNLRIVGITGSN
GKTTTKNLLRAILEQSGPTVAPRASFNNEVGAPVTMLEVSERTQYLVAEMGASGIGEIAR
LVRMARPDIGIVLTVGLAHAGEFGGIEKTLAAKTEMVSDLLDSDVAVLNRDDPRVASMAD
KTAARVLWFGLDDRGAVRASDIRSTSRGTSFVLRLPGADGGGAVSRPVRFRVLGEHHVMN
ALAAAAAAHTLGIGIDRIVAGLETVQRAERWRMEVLGGAGGVTVINDAYNASPDSMSAAL
KTLAQIAGPGERTIAVLGEMSELGELSGEEHDRIGLLAVRLGIDQLIVVGPPARRMHITA
INEGSWDGESLYCESQDAAYDHLKDTLRAGDTVLVKSSNSAGLRFLGDRLGELFS
Download sequence
Identical sequences U3PA05
WP_021755145.1.53511 gi|545629681|ref|YP_008580255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]