SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337285599|ref|YP_004625072.1| from Thermodesulfatator indicus DSM 15286

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|337285599|ref|YP_004625072.1|
Domain Number - Region: 9-92
Classification Level Classification E-value
Superfamily AF1862-like 0.0379
Family Cas Cmr5-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337285599|ref|YP_004625072.1|
Sequence length 137
Comment hypothetical protein Thein_0223 [Thermodesulfatator indicus DSM 15286]
Sequence
MTKTNLDKVAQDHARKMLDVSDKETLERLVTKALGVLQNQGVYAMMLFLFSRSSKEKEIA
PVIRNSLYDALKRLVNFKNETIVDSPKEALEFYSQKVVENLDTLLLVRDLYEQTLIYARF
HAKAAKEEQSGSTEEAA
Download sequence
Identical sequences F8AE46
gi|337285599|ref|YP_004625072.1| WP_013906855.1.56968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]