SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337286699|ref|YP_004626172.1| from Thermodesulfatator indicus DSM 15286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337286699|ref|YP_004626172.1|
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily AF1862-like 3.53e-27
Family Cas Cmr5-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337286699|ref|YP_004626172.1|
Sequence length 141
Comment CRISPR-associated protein, Cmr5 family [Thermodesulfatator indicus DSM 15286]
Sequence
MKTKAQERAKFAYEKVKEALEILGKGSAKEFSSFVSGLPAMILQNGLGHTLCFLLAKAAN
QKESKYKKTGKEAKYWLAFEALAEWLKKQDLLNYDPDNPAQTIHELTRKRALEYLALQEE
ALRFLEWFKVMTKMFVEEKSA
Download sequence
Identical sequences F8A972
WP_013907950.1.56968 gi|337286699|ref|YP_004626172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]