SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|337287363|ref|YP_004626836.1| from Thermodesulfatator indicus DSM 15286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337287363|ref|YP_004626836.1|
Domain Number 1 Region: 32-181
Classification Level Classification E-value
Superfamily PEBP-like 1.7e-42
Family Prokaryotic PEBP-like proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337287363|ref|YP_004626836.1|
Sequence length 182
Comment PEBP family protein [Thermodesulfatator indicus DSM 15286]
Sequence
MKWIKFFLIPISFFLIGAMIWASKGKGNMTLTSSFTDKGRIPLKYVMPAAGGQNISPPLK
WEGAPSQTKSFALLCVDLHPIANHWVHWMVINIPKNVNFLPEGASRHKMPKGSKELKNSF
GFIGYGGPQPPPGTGEHPYVFTIFALDVARIDLPEDASLEMFSQTIKKHVLAQANLTGYF
SR
Download sequence
Identical sequences F8AD06
WP_013908611.1.56968 gi|337287363|ref|YP_004626836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]