SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337285482|ref|YP_004624955.1| from Thermodesulfatator indicus DSM 15286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337285482|ref|YP_004624955.1|
Domain Number 1 Region: 2-297
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.14e-83
Family ADP-ribosylglycohydrolase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337285482|ref|YP_004624955.1|
Sequence length 305
Comment ADP-ribosylation/Crystallin J1 [Thermodesulfatator indicus DSM 15286]
Sequence
MTLRERYTGCLLGLAVGDALGAPLEFQARDLFEPVTDMIGGGPHFLEPGQWTDDTSMALC
LAESLIEKGGFDPHDQMERYCRWYEEGYLSSTGVCFDIGNTVKKALEKFRQTGNPFAGSK
DPWSAGNGCIMRLAPVPMFFYPDIEKAEWYAQESARTTHGAQECLDAARLFARMLIRALA
GKPKEEILLADSENFEASPKILDIARGAYFEKEEYEIRGTGYVVESLEAALWCFWQSESF
EEAVLMAINLGDDADTTGAVCGQIAGAYYGEKAIPERWLKKLTMAEKIRNTALKLLEAAT
RRSEK
Download sequence
Identical sequences F8A8U4
WP_013906738.1.56968 gi|337285482|ref|YP_004624955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]