SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568163909|ref|YP_008947338.1| from Sulfolobus acidocaldarius SUSAZ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568163909|ref|YP_008947338.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily LigT-like 4.01e-40
Family 2'-5' RNA ligase LigT 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568163909|ref|YP_008947338.1|
Sequence length 195
Comment 2'-5' RNA ligase [Sulfolobus acidocaldarius SUSAZ]
Sequence
MLRLFTGVNVPNYEKINELMQAINRTGADIKLVEPWNIHITLVFIGEVHENKLELIKDGL
KRISFNKFKVRLHGTGAFPSLGKPRVVWVGIDEGAIELRMIRGSIYKELVNRGIRPDEEK
EFSPHLTIGRVRGPRNMQNLIQVINEYQGTDFGEFTVEKFTLYKSTLTQKGPIYEPLLEV
ESNVGGGESFRTNKT
Download sequence
Identical sequences V9S616
gi|568163909|ref|YP_008947338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]