SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384539232|ref|YP_005723316.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539232|ref|YP_005723316.1|
Domain Number 1 Region: 54-117
Classification Level Classification E-value
Superfamily TrpR-like 0.000000000000068
Family SPO1678-like 0.064
Further Details:      
 
Domain Number 2 Region: 3-54
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000167
Family SPO1678-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384539232|ref|YP_005723316.1|
Sequence length 195
Comment hypothetical protein SM11_pD0983 [Sinorhizobium meliloti SM11]
Sequence
MSKHSRAFKQSVVEFYLRGNDGYGKAGAEFGIDHSTVLKWVAIYEAHGVAGLSKKFSSYD
AEFKLSVLKRMWEDGLSCRQTAALFNIRNAGCLSDWERRYEIGGIDALAPRRRGRPRTMP
EPPLPKQPQAPQNDETKSRAELLAELNYLRLEAVLKLAGLSRSTFYYHQKMASVADRTAL
TPGRLALSGRWLFPR
Download sequence
Identical sequences F7XGY9
gi|384539232|ref|YP_005723316.1| gi|384539232|ref|YP_005723316.1|NC_017326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]