SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387908991|ref|YP_006339297.1| from Streptococcus thermophilus MN-ZLW-002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387908991|ref|YP_006339297.1|
Domain Number 1 Region: 5-448
Classification Level Classification E-value
Superfamily SIS domain 1.48e-135
Family Phosphoglucose isomerase, PGI 0.000000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387908991|ref|YP_006339297.1|
Sequence length 449
Comment glucose-6-phosphate isomerase [Streptococcus thermophilus MN-ZLW-002]
Sequence
MAHIKFDYSKVLDKFVAPHEVDNLQAQVTVADEMIRKGTGPGADFLGWRDLPENYDREEF
DRILKAAEKIKEESDVLVVIGIGGSYLGAKAAIDFLSNHFANLQTKEERKAPQIVYAGNS
ISSTYLADLLEYVEGKDFSVNVISKSGTTTEPAIAFRLFKELLVKKYGQEEANKRIYATT
DRQKGAVKVEADANGWETFVVPDDIGGRFSVLTAVGLLPIAVSGADIKALMEGANAARKE
YSSSKISENEAYQYAAIRNILYRKGYTTEILANYEPSLQYFAEWWKQLAGESEGKDQRGI
YPTSANFSTDLHSLGQFIQEGTRNLFETVVRVDKPRKNVVIPELAEDLDGLGYLQGKDVD
FVNKKATDGVLLAHTDGDVPNMFITIPEQDAFTLGYIIYFFELAIALSGYLNAVNPFNQP
GVEAYKKNMFALLGKPGFEELGAELNARL
Download sequence
Identical sequences A0A0E2Q3D7 A0A0M4HCA6 Q03ML5 Q5M1N9 Q8VVB7
322159.STER_0241 gi|116627134|ref|YP_819753.1| WP_011680683.1.14318 WP_011680683.1.20409 WP_011680683.1.20570 WP_011680683.1.25847 WP_011680683.1.40951 WP_011680683.1.45745 WP_011680683.1.46579 WP_011680683.1.49400 WP_011680683.1.52035 WP_011680683.1.53867 WP_011680683.1.56630 WP_011680683.1.60701 WP_011680683.1.61748 WP_011680683.1.61786 WP_011680683.1.622 WP_011680683.1.6714 WP_011680683.1.71797 WP_011680683.1.77140 WP_011680683.1.77415 WP_011680683.1.83814 WP_011680683.1.84427 WP_011680683.1.86693 WP_011680683.1.90490 WP_011680683.1.91396 WP_011680683.1.92232 WP_011680683.1.92807 WP_011680683.1.94133 gi|386085897|ref|YP_006001771.1| gi|387908991|ref|YP_006339297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]