SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385778415|ref|YP_005687580.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778415|ref|YP_005687580.1|
Domain Number 1 Region: 91-250
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.53e-48
Family PA2201 C-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385778415|ref|YP_005687580.1|
Sequence length 422
Comment hypothetical protein Clo1313_1065 [Clostridium thermocellum DSM 1313]
Sequence
MRDPLCSESYLLETIEFDKEAIDENKKDIVELKDDMEKGIQRYPRDNQSIIYATFLHMFM
YNTETLIAKYSLGSHPDEMIEDYLNGIEYLENVGEEKVWYIDLLWMLSLGILLEVDKEDL
KRLACVIEKQKKEDALMDFLLKACDIGWNHNTSEYERKNPYAKTAEIIQMALHDKDREKA
SKRLQQYIEKEWIKGHNDLDFKNAHKEPGYVGLWSFEAAALAKILGLDDSALKDNNHYPY
DLAHYKNGMSFDLSWYGVPVEEEVKKEEEAIVYGITNKPELEQIIPAKFHSFVNEVIGDY
NTLTDEEFWKKYNLREIWFDVKEYKEDNKSKNMLGTIIVFLLVEKEYILQLDYKEDLVDY
IEDIDNYWGKEEVKLISFEVDNDQQYYAYVPKTAAIDSLYEVKLTEVEKIEEVWQCKYFC
VN
Download sequence
Identical sequences WP_014522611.1.19387 WP_014522611.1.20586 WP_014522611.1.6636 gi|385778415|ref|YP_005687580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]