SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385779955|ref|YP_005689120.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779955|ref|YP_005689120.1|
Domain Number 1 Region: 91-250
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 8.24e-48
Family PA2201 C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385779955|ref|YP_005689120.1|
Sequence length 412
Comment hypothetical protein Clo1313_2677 [Clostridium thermocellum DSM 1313]
Sequence
MRDPLCNKEDLIETIEFNQQTICEMKEEIEELKADIENGIQRYPRDNQSIIYITFADMFR
YGMDMLLAKYSLGNHPDTMIDDYLDNITYLENCGEEEAGYINLLWMVGLGILLEMDKEVL
KRLARVIERQRIEDALMDFLLKACDIGWNHSTTKYEKKNPYEKTAEIIKIALHDKDKEAA
SKRLEKYMGKEWFKGHYDFGWRNAHKEPGYYGFWSFDTAALAKILGLDDSALKDNNHYPY
DLAHYKNGMTFDLSWYSVPKEEEDKEEETVVYGIPGNPELERIIPGKFHSFVNEIINDYK
TLPDEEFWKKYNLKEIWFDVEEYKEDNKDKNLLGTIIVFMLVDKDYILQLDYKEELIDYI
ENIHNYWAKKEVKLISFELDNDQQYYAYVPKDAEVGSLYEVKLTEVEKIEEV
Download sequence
Identical sequences WP_003514987.1.19387 WP_003514987.1.20586 WP_003514987.1.55520 WP_003514987.1.60145 WP_003514987.1.6636 WP_003514987.1.6965 gi|385779955|ref|YP_005689120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]