SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385778940|ref|YP_005688105.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778940|ref|YP_005688105.1|
Domain Number 1 Region: 11-313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-57
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 417-644
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 7.85e-19
Family Tricorn protease N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385778940|ref|YP_005688105.1|
Sequence length 695
Comment serine/threonine protein kinase [Clostridium thermocellum DSM 1313]
Sequence
MLVSSDDYIKKYEPLWGAWFVESFIGEGSYGKVYKIYKEEWGFKYQSALKFISIPTQEQH
REALATIGNDKNSLEQYFESAVKNIVNEIHMMYTLRGNTNIVSYEDHLVQKSSNRFGWDI
LIRMEYLTTLNKYILKNGLTRVGVVNLALDICSALEICEQKRIIHRDIKDENIFVTSDGK
FKLGDFGIAKELTRLSLASSIRGTPLYMAPEVYRGKPYDSRSDLYSLGIVMYKLLNHGRF
PFMPPYPQELKYKDSETALDKRLSGEAITPPMLAGEKLSQFILKICAYNPDERYASATEA
KKALYEILSEMSSEERSYWVVPPAAADEAEKADDTEKVIDTVILPQSDIANQNEKNTDDE
CMDTVLLEVPKPPQAPKKTLDRTVSIFGSLLRREMVYNLTGNHSGNILNGGLVCTQGSWL
YFSNAGCDFNIYKVKLDGSDLQRINNDESWFLNVCGNWIYYTDPNNDDNIFRIDLEGNGK
TRLNTDRSWDITVCGEWIYYINESDGYKLYKIKTDGTERTKLNNDFTQSLFLKDDWLYYS
NKSDGGKIYKINTLGKGRTRIVNDEASYINVYGDYIFYCNKSDGFKLYRASIDGRSKNKL
NDDISYNINVSNGWIYYCNKSDGGSIYRIRTEGTDKTKLNNENSEFINLANEHIYYCSKL
NSGKLYSISLGGSNRTKISMDKNHNEDDDEGWFYL
Download sequence
Identical sequences A3DD40
203119.Cthe_0634 gi|125973152|ref|YP_001037062.1| WP_003516573.1.16390 WP_003516573.1.19387 WP_003516573.1.20586 WP_003516573.1.31213 WP_003516573.1.55520 WP_003516573.1.6636 WP_003516573.1.6965 gi|385778940|ref|YP_005688105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]