SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385780196|ref|YP_005689361.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385780196|ref|YP_005689361.1|
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 8.11e-28
Family Ribosomal protein L9 C-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.13e-18
Family Ribosomal protein L9 N-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385780196|ref|YP_005689361.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Clostridium thermocellum DSM 1313]
Sequence
MKVILKEDVKGLGKKESLVEVSDGYARNFLIPKGLAVEATAANINIMQTKKEAEKNRKER
ELAQAKELAEKLKGIVVTLKAKAGENGKLFGSMTSKDVSDYLKKQHNLDIDKKKISLPES
MKSLGTYEAEVKLYPGVSAKLTVKIEQE
Download sequence
Identical sequences A3DHN0
203119.Cthe_2257 WP_003513534.1.16390 WP_003513534.1.19387 WP_003513534.1.20586 WP_003513534.1.31213 WP_003513534.1.55520 WP_003513534.1.60145 WP_003513534.1.6636 WP_003513534.1.6965 gi|385780196|ref|YP_005689361.1| Cth-1565 gi|125974742|ref|YP_001038652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]