SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340787557|ref|YP_004753022.1| from Collimonas fungivorans Ter331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340787557|ref|YP_004753022.1|
Domain Number 1 Region: 165-349
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-59
Family Methylesterase CheB, C-terminal domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily CheY-like 5.83e-20
Family CheY-related 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340787557|ref|YP_004753022.1|
Sequence length 352
Comment chemotaxis response regulator protein-glutamate methylesterase 4 [Collimonas fungivorans Ter331]
Sequence
MKIGIVNDAPIAVEALRRTLVQRQDHEIIWIAEDGQRAIELCAWQVPDLILMDLMMPVLD
GVAATRHIMAHTPCAILIVTGDVGANVSAVYDAMAYGALDAIDTPSTLSGYQRNDVNTML
AKIDSIEKLLNQRQSLPEQRAPAAAAVTTTAAAGAKRTSLPAPDSKYLIAIGASAGGPAA
LATLLSQLPADFPAALVVVQHVDAQFASGMAEWLSGQSKLPVRLAQAGDSPAPGQVLLAG
TDDHLRLTRPFQLGYTEQPSGYPYRPSIDVFFQSVVELWAGKAVGILLTGMGRDGALGLK
AMRDKGYYTIAQDRESSAVYGMPKAAALLDAADAILPVNQIAAKLVSIICKR
Download sequence
Identical sequences G0AC02
gi|340787557|ref|YP_004753022.1| WP_014006352.1.9183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]