SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340788367|ref|YP_004753832.1| from Collimonas fungivorans Ter331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340788367|ref|YP_004753832.1|
Domain Number 1 Region: 161-314
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.24e-35
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0019
Further Details:      
 
Domain Number 2 Region: 12-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000251
Family AraC type transcriptional activator 0.0087
Further Details:      
 
Domain Number 3 Region: 65-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000538
Family AraC type transcriptional activator 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340788367|ref|YP_004753832.1|
Sequence length 316
Comment AraC family transcriptional regulator [Collimonas fungivorans Ter331]
Sequence
MTSQENQVAYARRMHKVIEHIDRHIDQTLELSTLAEVAHFSAFHFHRLFSAWMGETLGDY
LRRRRLEMAALRLIGQPGVPVLEIALSVGFGSTEAFARAFKIRFGCTASEWRQGQADRWA
AQLAAGRNSNPGQPHRKQDQENSPIPDHHGNSQTDTMEIPMKVKIVQRTAAKIAYLRYIG
PYGQPISEFWGETVCPWMETNDLFGRPRYGISHDDPGIASADKCRYDAGVEVPDDFVASG
KSFSTTVPGGSYAVTRYAGTGRDIGETWTRLLRDWLPASGMQLDTRPFFEYYPVDAGYDE
KTGIFECDLCIPVVPL
Download sequence
Identical sequences G0AA75
WP_014007162.1.9183 gi|340788367|ref|YP_004753832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]