SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340785411|ref|YP_004750876.1| from Collimonas fungivorans Ter331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340785411|ref|YP_004750876.1|
Domain Number 1 Region: 14-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.43e-60
Family Phosphate binding protein-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340785411|ref|YP_004750876.1|
Sequence length 299
Comment putative amino-acid-binding periplasmic, ABC transporter protein [Collimonas fungivorans Ter331]
Sequence
MGAYVMHGAIKHGLTLFFILAPLAATAGDTLGKIRDSQTITFAYRQTAPFSYTNDNKQIV
GYSIDLCQKIADAVKRELKLPNLKVQYLPVDSSTRFSSIIDGKADLECGSTTNNAERRTR
VGFTVPHFFSSVRMVVKNGSGIKNWSDLRNKTMVITKSTTTIDLVNDRSNVRSLNIKVLE
AQDDAESFAFVEQGKADAYAMDDVLLYSLRSTAKNPADYTILGDPLSIEPYSLMLRKDDP
AFKKVVDQEMVRLINEGELKKIYSYWFTQPNGPKGSNLNMPMGYLLRDSLQYPSDKTAQ
Download sequence
Identical sequences G0AHL4
WP_014004208.1.9183 gi|340785411|ref|YP_004750876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]