SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340786072|ref|YP_004751537.1| from Collimonas fungivorans Ter331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340786072|ref|YP_004751537.1|
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.52e-19
Family N-terminal domain of molybdate-dependent transcriptional regulator ModE 0.013
Further Details:      
 
Domain Number 2 Region: 187-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000272
Family Phosphate binding protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340786072|ref|YP_004751537.1|
Sequence length 358
Comment putative molybdenum-binding protein [Collimonas fungivorans Ter331]
Sequence
MYKVKIKPHWEISRDAEPPLDTAVLLALLTAIQETGSIANAAKQTGSSYRHAWGLLRDAE
RMFGHPLISTGRGRGSRLLPLAEKLIWADRRIAARLSPTLETLASELEGELSKTVSGQPQ
VIRLNASHGFAVAALLNQLNDRRLPVELRYRNSADAVAALARQECDLAGFHVPLGEFEDA
SVASYSHWLDKDKHCLIHLAVRNQGLMVAPGNPKNIAGLPDLSREGVLFVNRQTGSGTRM
LLELMLSRQALSPTAIEGFETAEFTHSAIAAFIASGMADVGFGVQTAAHRFGLDFIPLVR
ERYFFAVSSAAMKDPLMQQVIAILQSASFRDIVNQLNGYDGSATGEILSLAEAFESLQ
Download sequence
Identical sequences G0AID1
gi|340786072|ref|YP_004751537.1| WP_014004869.1.9183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]