SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340787994|ref|YP_004753459.1| from Collimonas fungivorans Ter331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340787994|ref|YP_004753459.1|
Domain Number 1 Region: 34-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.16e-43
Family Phosphate binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340787994|ref|YP_004753459.1|
Sequence length 345
Comment family 3 extracellular solute-binding protein [Collimonas fungivorans Ter331]
Sequence
MKFSWKQFGIALCLFLAGYFTFNGKLFAQTPEKTKVAIAVGGKNLFYYLPLTIAEQLGYF
KDEGLDVTISDFAGGAKALQALVGGSADVVSGAFEHTISMQAKNQHIVAFVLQGRAPQIV
MGVSNKTMPNYKSIADLKGKKIGVTAPGSSTSMMSNFVLAKGGLKPTDVSYIGVGASAGA
LSALRSGSIDVIANLDPLITMMQQNNEIRIIADTRTLKDTNAVFGGPMPAATLYASADFI
KKYPNTTQALTNAMVRALKWLQKAGPSDIVKTVPESYQLGDRALYIEAFMKVREAISPDG
TIPDAGPQVALRTLQAFDPDLAGKNIDLSQTYTNEFVKKANAKYK
Download sequence
Identical sequences A0A127PEC7 G0A9L3
WP_014006789.1.49382 WP_014006789.1.9183 gi|340787994|ref|YP_004753459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]