SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340789616|ref|YP_004755081.1| from Collimonas fungivorans Ter331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340789616|ref|YP_004755081.1|
Domain Number 1 Region: 45-341
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.6e-52
Family Phosphate binding protein-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340789616|ref|YP_004755081.1|
Sequence length 369
Comment ABC transporter substrate-binding protein [Collimonas fungivorans Ter331]
Sequence
MTPMLIKKTLAAAIAAVSLGLALNASAQAPAGYPADYAKIVDGAKKEGKLVIYSATDSKA
AEPLIKDFSTLYPGVKVEFNDMNSTEVYNRFISEAAAGGATADVLWSSAMDLQFKLASEG
YAAVYKSQEAAAIPAWANYKDSAYGTTFEPLAIVYNKRLVSADEVPATHADLVKLLTAKA
DKFRNKVTTYDIEKSGVGFSFITEDAQINPQFWDLAKTFGDVGIRVQSSTGTMLERISSG
ENLIGYNVIGSYAQARAAKDPSIGVSFTKDYNLVLSRVAFINKSAKNMNAAKLWIDYLLS
KRGQTIISNESQLYALRADVTGHNTLGSLTTQLGGALKPIAITPTLLQYLDQTKRLAFLK
QWKAAAGKK
Download sequence
Identical sequences G0AFT8
gi|340789616|ref|YP_004755081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]