SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000328 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000328
Domain Number 1 Region: 776-947
Classification Level Classification E-value
Superfamily SPOC domain-like 1.37e-50
Family SPOC domain 0.00013
Further Details:      
 
Domain Number 2 Region: 177-258,364-436
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.15e-19
Family Canonical RBD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000328   Gene: ENSSARG00000000360   Transcript: ENSSART00000000362
Sequence length 967
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4831:121500:127730:1 gene:ENSSARG00000000360 transcript:ENSSART00000000362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSAGRDPLPRRSPKWRRAVPLCETSAGRRVNQLRGDDLRRPTTMKGKERSPVKPKRSRG
GEESTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSS
SRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPDGGEYKTLKISELGSQLSD
EAVEDGLFHEFKRFGDVSVKISHLSGSGGDERVAFVNFRRAEDARAAKHARGRLVLYDRP
LKIEAVYVSRRRSRSPLDKDAYGLSSSLAGMSVSSHRHAPGGGGGQRSLSGGAALGYRDY
RLQQLALGRLPPPPPPPLPRELERERDYQFYDRVRPTYSLEPRVGAGGGAPFGEVDEILE
NDQRANRTLFVGNLDITVTESDLGRAFDRFGVITEVDIKRPSRGQTSTMAFLKFENLDMS
HRPKLAMSGKFIIRIPIIGYGRATATTRLLVGCFGPWVLAALALEFDRFGTIRTPDRRVD
SLGRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPPVRERSTRTTAAAVPA
YEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLAEESGGRHLDRSPESDRPRKRHC
APSPDRSPELSSSRDRYNSDNDRSSRLLLLERPSPIRDRRGSLEKSQSDKRDRKNSASAE
RDRKHRTAAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPTQKQDSGSASTASASPKLCL
AWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGTTGGKVAQLKITQRLRLDQPKLDEVT
RRIKVAGPNGYAILLAVPGSSDSRSSSSATSDTATSTQRPLRNLVSYLKQKQAAGVISLP
VGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRVFGFEKGERNEKE
IELTVLH
Download sequence
Identical sequences ENSSARP00000000328 ENSSARP00000000328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]