SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000648 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000648
Domain Number 1 Region: 53-183
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.24e-26
Family Matrix metalloproteases, catalytic domain 0.00026
Further Details:      
 
Domain Number 2 Region: 402-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.16e-17
Family Hemopexin-like domain 0.0019
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-16
Family MMP N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000648   Gene: ENSSARG00000000696   Transcript: ENSSART00000000708
Sequence length 542
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_6933:344:7318:1 gene:ENSSARG00000000696 transcript:ENSSART00000000708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWLRRFGYLPPADPETQPLQTPEELSSAISSMQQFGGLEATGLLDEATLALMRTPRCSLP
DIPAEAASARKRRQAPAPARWNKRSLSWRVRTFPRDSQLGRDTVRALMYYALKVWSDIAP
LDFHEVAGSAADIQVDFSRAAHDDRFPFDGPGGALAHAFLPGDHRTAGDAHFDDDEVWTF
RSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEHTRRMDPGHPAPSPPW
TGLPSTLDAAMRWSDGASYFFRGNDYWKVLDGELQVAPGCPRPTAHDWLVCGELPARPEG
TARGPEEAGPPALPGRQGHSRSEDGYEVCSCTSQGPPAPLLAAPLLLLLLLLAGVGVAQA
PL
Download sequence
Identical sequences ENSSARP00000000648 ENSSARP00000000648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]