SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000857 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000857
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.51e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.00000024
Further Details:      
 
Domain Number 2 Region: 613-719
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-30
Family SH2 domain 0.000000688
Further Details:      
 
Domain Number 3 Region: 302-437
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-30
Family SH2 domain 0.0000011
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.00000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000857   Gene: ENSSARG00000000928   Transcript: ENSSART00000000931
Sequence length 722
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_3904:10945:90504:1 gene:ENSSARG00000000928 transcript:ENSSART00000000931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYEYKKEREEDIDLHLGDILTVNKGSLVALGFSEGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKAEVDSEQQALSLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLESSTLYRAQSASNPAELRQLLDCDAGSVDLDMIDVQ
VLADAFKRYLLDLPNPVIPGAVYNELVSLAQEVQSSEEYTQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQAYSKNLLTARVLAELFSPLLFRFPATSPENTESLIKVTEILISTEWNE
RQPAPALPPKPPKPTPVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKESIEKFKREGNEKEIQRNMHNYEKLKSRISIVDS
RRREEDLMKQAAEYREIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVV
VDGEVKHCVINKTATGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQ
RR
Download sequence
Identical sequences ENSSARP00000000857 ENSSARP00000000857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]