SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000002345 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000002345
Domain Number 1 Region: 20-142
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.06e-42
Family Vertebrate phospholipase A2 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000002345   Gene: ENSSARG00000002609   Transcript: ENSSART00000002590
Sequence length 143
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5553:103339:109108:-1 gene:ENSSARG00000002609 transcript:ENSSART00000002590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPPLLTFLCLLVAPAGGNLVQFGVMIERMTGKSALQYNDYGCYCGIGGSHWPVDPTDW
CCHAHDCCYGRLQKLGCEPKLERYLFSTTKCNIFCGGKTACQRQTCECDRTAALCFRRHL
RTYNRKYANYPNRLCTGPTPPCR
Download sequence
Identical sequences ENSSARP00000002345 ENSSARP00000002345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]