SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003803 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003803
Domain Number 1 Region: 432-821
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-123
Family Ankyrin repeat 0.000000000411
Further Details:      
 
Domain Number 2 Region: 179-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.85e-74
Family Ankyrin repeat 0.00000228
Further Details:      
 
Domain Number 3 Region: 46-229
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-44
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 4 Region: 4066-4176
Classification Level Classification E-value
Superfamily DEATH domain 1.06e-25
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003803   Gene: ENSSARG00000004042   Transcript: ENSSART00000004189
Sequence length 4361
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4223:16853:415634:-1 gene:ENSSARG00000004042 transcript:ENSSART00000004189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEVNVEDEAEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLVVA
LQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNADVESKSGFTPLHIA
AHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAHMVKLLLDRGAKIDAKTRDGL
TPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDD
VTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKH
GASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVV
RYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNSATTSGYTPLHLSARE
GHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDASGKSGLTPL
HVAAHYXXXXXXXXXXXXXXXXXXXXXNGYTPLHIAAKKNQMDIATTLLEYGADANAVTR
QGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKNGLTSLHLAAQEDRVNVAEVLVNQGAI
VDASDKMGYTPLHVGCHYGNIKIVNFLLRHSAKVNAKTKNGYTPLHQAAQQGHTHIINVL
LQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTVTEKHKMNVPETMNE
VLDMSDDEVRKANTPEMLSDGEYLSDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAEGY
MGFSMGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLIPSKEQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITC
RLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRS
ENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQ
ESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPI
VTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITG
TTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMND
PVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKE
TESDQDDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXERSAGAARSLPTTYSYKPFFSTRP
FQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSVK
SISDVASPIRSFRTISSPIKTVVSQSPYNIQVSSGTLARAPGITEASPLKGLASNSTFST
RTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVMSPA
KSAVDVVSSAKVTMASSLSSPVKQLPGHAEVALVNGSISPLKYPSSSTLINGCKATATLQ
EKISIATNSVSSAVSAATDTVDKVFSTTTAMPFSPLRSYVSSAPSAFQSLRTPSTSALYT
SLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKIPDSHSLTKSAAALLSPIKTLTTE
TRPQPHLTRSSSPVKSSLFLTPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTD
VPEEKPFQPEPPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGPPKSPKSDKG
LSPEEDWIEFSSEEIREARQQATASHSPSLPERVQVKAKAASDKDYNLTKVIDYLTNDIG
SSSLTNLKYKFEDAKKDGEERQKRILKPAIALQEHKLKMPPASMRPSTSEKELCKMADSF
FGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVI
TETRTEVVHVIRSYEPSAGEAPLSQPEEPASPKPAPAFMELEPKPTTSSIKEKVKAFQMK
ASSEEDDHNRVLSKGMRVKEETHITTTTRMVYHSPPGGEGASERIEETMSVHDIMKAFQS
GRDPSKELAGLFEHKSAVSPDVHKSAAETSAQQAEKDNQMKPKLERIIEVHIEKGNQAEP
TEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAEES
LPSYLESSRVNTPVSQEEDSRPSSAQLVSDDSYKTLKLLSQHSIEYHDDELSELRGESYR
FAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDKRPREKVVTAPKKEILSKIYKDV
SENGVGKVSKDEPFDKVTVLHYSGDVSSPKHAMWMRFTEDRLERGREKLIYEDRVDRTVK
EAEEKLTEVSQFFRDKTEKLNDELQSPEKKPRPRNGKEYSSQSSTSSSPEKVLLKELLAS
NDEWIKARQHGRDGQGFPKAEDRKASSLPSSPEKKSLSQHTEESKSTEEVKGSIAQSKAT
EGPQSGFQLKQSKLSSIRLKFEQGTQAKRKDISQDDKKPDGQSRIPVKKIQESKLPVYQV
FAREKQQKAVDLPDDSVSVKKDSVVLKAKDEHAQSNEIVVNDSGSDDVKKQRTEMSSNAM
PDYFSEQQAKDLACHVTSDLATKGPWDKKVFRTWESSGATNNKLQKEKLSHVLVHDVREN
HIGHPESKVVDQRNEFMSVTEREHKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGECP
GGSFDQLSRRSESTAVSHIPVRVAEERRMPSANIPDGFPEQTTIPNHELSQKLPQSSMSK
ETVETQYFNSVEDEKVSYSEISKVSKNHNFVGLCPPREETETSPTKSPDSLDFSPGKESP
SSDVFEPSPVDRVEKVAPLAQSEGGKEIKTLPVYVSFVQVGKQYEKEIQQGSVKKIISQE
CKTVQETRGTFYTSRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPRSEGVGYEF
TSKIPDSLIAYIPGKPSPIRQVSEESEEEEQARSASLKTTREAVKQEMSLNGRDSTRPKY
KAYIEFPPPPPLDPEQMESDKKHHYLQEREVDMIEVNLQDEHDKYQLAEPVIRVQPPSPV
PPGADVSDSSDDESIYQPVPVKKYTFKLKEMDEEHKEMTKSKASAEKASSQKEVEKNGSG
KDHELGLGLDSPQNEAAQNGNNDQSVTECSIATTAEFSHDTDATEIDSLDGYDLQDEDDG
LTESDSKLPSQTMEIKKDVWNTEGILKPADRSFSQSKLEVIEEEGRVGLDEDKPPSKTAS
YEKTSDKTEQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWS
SNRGDDEVFDSQSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNPFPFHEG
KMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSIVTATPQPQSGDTT
VETNLERNVEAPAVEPNPSIPTSGECQEGSSSSGSLEKSSAATNTSKVDPKSRTPIKMGI
SASTMTMKKEGTGEVTDKIEAVVTSCQGLENETITMISNTTDSQVGIRPPEKHDFQKDNF
NNNNNLDSSTMQTDNITSIVALTEHSTPTCTTEKTNPVKSSSGKKTGVLQGHCTRDKQKV
LGEQQKTKELIGIRRKSKLPIKATSPKDIFPNHMPNIKVSKMKQVSSSEKAKTLSSSCVD
VKSRIPIKNTHRDNIVSVRKACATQKHGQPERGRAKPLPSKLPVKVRSTCVTPTNTTTTT
TTTTVKVRKSQLKEVCKHSIEYFKGISGETLKLVERLSEEDKKMQSELSDEEDSTSRNTS
LSETSRGGQPSVTSKSARDKKTEAASLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIV
ADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSV
LTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXPDQCRDSITSYLKGEPGKFEANGSHAEVTPEAKTKSYFSESSNDVGKQ
SPKEALKPKLHGSGRVEEQAAASLAAYQKSVEETSKFVSEEPKPCVPVSMKKMSRTSPAD
GKPRLNLHEEEGSSGSEPKQGEGYKMKMKKEIRHVEKKSHS
Download sequence
Identical sequences ENSSARP00000003803 ENSSARP00000003803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]