SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000004254 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000004254
Domain Number 1 Region: 222-508
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 5.1e-86
Family Cryptochrome/photolyase FAD-binding domain 0.000021
Further Details:      
 
Domain Number 2 Region: 26-112
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 8.24e-34
Family Cryptochrome/photolyase, N-terminal domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000004254   Gene: ENSSARG00000004656   Transcript: ENSSART00000004681
Sequence length 545
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_2427:53279:93921:1 gene:ENSSARG00000004656 transcript:ENSSART00000004681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAAAAAAAAEAAPAPAARAEGACSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILD
PWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIELNGQKPPLTYKRFQAIIG
RMELPMKPVGSVSRQQMESCRAEIQENHDETYGVPSLEGLGFPTEGLGPAVWQGGETEAL
ARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYSLWDLYKKVKR
SHTPPLSLFGKLLWREYTSATNHPRSDRMENPICIPDPWDRNPEALAKWAEGKTGFPWID
AIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPEAVQKAAKCV
IGVDYPRPMVNHAETNRLTIERMKQIYQKLSSYWGHCLLASVPSCVEELSNPMAEPSGSQ
AGSSA
Download sequence
Identical sequences ENSSARP00000004254 ENSSARP00000004254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]