SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000005685 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000005685
Domain Number 1 Region: 613-868
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 2-261
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 312-551
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 960-1112
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000196
Family YWTD domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1303-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1224-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 569-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1265-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 870-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 264-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000568
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 1182-1235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000766
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000005685   Gene: ENSSARG00000006249   Transcript: ENSSART00000006269
Sequence length 1591
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_522:12221:137306:-1 gene:ENSSARG00000006249 transcript:ENSSART00000006269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APLLLYANRRDLRLVDATNGRENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRAE
FNRTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQ
PRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRYIIINTEIYWPNGLTLDYEERKLYWA
DAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLR
EIHSNIFSPMDIHAFSQQRQPNATNPCGSDNGGCSHLCLMSPVKPFYQCACPTGVRLLEN
GKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDD
EVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKI
LISEDLEEPRAIVLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDY
DEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVH
KRSAEREIIIDQLPDLMGLKATNVHRIFGSNPCAEENGGCSHLCLYRPQGLRCACPIGFE
LISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWT
DISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHR
QVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTID
YAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERAN
KTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAH
YSLNADNRTCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
YWIDSRQNVIRKAQEDGGQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVIN
VTRDGRSIGXXXXXXXXXXXXXXXXXXXXYMYFTNQERSPKIERAALDGTEREVLFFSGL
SKPIALALDSRLGKLFWADSDLRRIESSDLSXXXXXXXXXXXXXXXXXXXXFENWLNWID
KQQNNEKINMTGRESRTKVQARIVQLSDIHAVKKLNLQEYRQHPCAQDNGGCSHICLVKG
DGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDE
LNCPVCSESQFQCASGQCVDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKH
KKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIITILVSGTIYFICQRMLCPRM
KGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDR
AHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSY
RHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEE
NYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSSARP00000005685 ENSSARP00000005685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]