SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000005731 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000005731
Domain Number 1 Region: 92-247
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.89e-50
Family Matrix metalloproteases, catalytic domain 0.0000000585
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000157
Family MMP N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 454-489
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.00000000144
Family Hemopexin-like domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000005731
Domain Number - Region: 292-318
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0628
Family Hemopexin-like domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000005731   Gene: ENSSARG00000006332   Transcript: ENSSART00000006318
Sequence length 563
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4495:10620:135162:-1 gene:ENSSARG00000006332 transcript:ENSSART00000006318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKNVTPKVGDPETRKAIRRAFDVWQNVTP
LTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDS
DEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQ
GIQKIYGPPDKIPPPTRPLPTAPPHRSIPPLDPRKNDRPKPPRPPTGRPSYPGAKPNICD
GNFNTLAILRREMFVFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTYFYKGKEYWKFNNQILKVEPGYPRS
ILKDFMGCDGPTDRDKEGHSPPNDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLIYTV
FQFKRKGTPRHILYCKRSMQEWV
Download sequence
Identical sequences ENSSARP00000005731 ENSSARP00000005731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]