SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006417 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006417
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.00000000000000483
Family Insect phospholipase A2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006417   Gene: ENSSARG00000007080   Transcript: ENSSART00000007078
Sequence length 306
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1659:372980:376092:-1 gene:ENSSARG00000007080 transcript:ENSSART00000007078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLKDTERCCWQHKQCGGHIIHPYTADCGHHNLHLHAVGHCDCDTRLKDCSEKVDSTTSSR
NPGPTCSHIIPTPCFEVIPEEECTDQFWYGWSEKYRPLIAVIHHPFHPKRREDVLEEEEE
EEEEGSKSPIPNQTGSVSPTETGPVTVTGTADSTAPITIWRSESPTAKPQANKTIKKIKK
KKEKEKEKDEDTDEKLKPKKKKKSKLVKKKSVVKAESSPPDSRSLCPRELTRTSESSPES
REELESEDSYNDPKREIFSPSEDIVESLPRKKEKNLPQAKKPGTKTSSTKKVTKRKSPPA
SIPNLS
Download sequence
Identical sequences ENSSARP00000006417 ENSSARP00000006417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]