SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008740 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000008740
Domain Number 1 Region: 273-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.54e-63
Family Hemopexin-like domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 163-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.52e-33
Family Matrix metalloproteases, catalytic domain 0.0000935
Further Details:      
 
Domain Number 3 Region: 32-96
Classification Level Classification E-value
Superfamily PGBD-like 2.35e-19
Family MMP N-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008740   Gene: ENSSARG00000009673   Transcript: ENSSART00000009670
Sequence length 509
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_3371:93425:103663:-1 gene:ENSSARG00000009673 transcript:ENSSART00000009670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFLLLHLLFATFSSAFPTDRKVEEEGNARFAQAYLNRFYRLELEESRLVQSKNRSVTD
GKIREMQAFFGLTVTGKLDPSTLEVMKTPRCGVPDVGHYGYTLPGWRKYNLTYXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGQCPRFFDGPLGVLG
HAFPPGLGLGGDTHFDEDENWTKDTTGFNLFLVAAHEFGHSLGLSHSNDQTALMFPNYVS
LDPSKNPLSQDDIKGIQSIYGLPEVPAKPRRHTVPQACDPDLTFDAITTFRREVMFFKGR
HLWRIYLDITDVEFELISSFWPSLPNDIQAAYENPKDKILVFKDAAFWMIRGYAVLPDYP
KSIYTLGFPKYVKKVDAVLCDHSTKKTYFFVGIWFWRYDEATQTMDRGYPRRVIKHFPGI
GLRVDAAFHHKGFFYFFCKSKQFEYDPKAKNVTRVMKTNTWFRCKTPLNASDFYIKEKVH
SGGIQMFCNNLNLFIFSIGYVLRKVSSNQ
Download sequence
Identical sequences ENSSARP00000008740 ENSSARP00000008740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]