SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008839 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000008839
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.31e-16
Family Vertebrate phospholipase A2 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008839   Gene: ENSSARG00000009789   Transcript: ENSSART00000009775
Sequence length 83
Comment pep:novel scaffold:COMMON_SHREW1:scaffold_136343:5766:7334:-1 gene:ENSSARG00000009789 transcript:ENSSART00000009775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCQELNSCWNQATEMENCSSTLDTYFKSYSYYCASSVITCSSESNPCEDFICNCDRTAAM
CFIKAPRPQEKYYNLDRKKYCRD
Download sequence
Identical sequences ENSSARP00000008839 ENSSARP00000008839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]