SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009775 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009775
Domain Number 1 Region: 198-488
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.09e-97
Family Cryptochrome/photolyase FAD-binding domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 15-136
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.15e-33
Family Cryptochrome/photolyase, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009775   Gene: ENSSARG00000010829   Transcript: ENSSART00000010821
Sequence length 584
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4221:33464:71977:-1 gene:ENSSARG00000010829 transcript:ENSSART00000010821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVPGFRKGAALHDKPALCECIQGADSIGCVYISDPRYAGSSEGITKWRFLLQCLED
LDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAG
VEVIVRISHTLYDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFDTDGLPSAVWPGGETEALTRLERHLERKAWVANFERPRMNA
NSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAAT
NNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAV
ACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRR
TDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNI
ERMKQIYQQLSRYRGLGLLATVPSNPNGNGGFMGYSPGENASGCSSSGSYFQGSGILRYA
YGDSQQTHLLKQGRSSSCTGLSSGKRPSQEEDRQSPKVQRQTTN
Download sequence
Identical sequences ENSSARP00000009775 ENSSARP00000009775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]