SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010282 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010282
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.39e-16
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00027
Further Details:      
 
Domain Number 2 Region: 227-291
Classification Level Classification E-value
Superfamily E set domains 0.000000000467
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010282   Gene: ENSSARG00000011370   Transcript: ENSSART00000011386
Sequence length 480
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1121:1126:6286:1 gene:ENSSARG00000011370 transcript:ENSSART00000011386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKLQWEEEATVNRV
QSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLR
GFPSAPGPPFGTDMDFSPPRPPYPSYPPEDPTYETPYMSEGFNYGTPPLYPQTGPPPSYR
PGLRMFPETGTTAGCARPSPVPFLPRPYPSDPYGGRGSPFPLGLPFPPPAPFRPPLPSSP
PLEGPFPPQSGVHPPPPESYSEVGPSYCPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEE
Download sequence
Identical sequences ENSSARP00000010282 ENSSARP00000010282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]