SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000011513 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000011513
Domain Number 1 Region: 267-446
Classification Level Classification E-value
Superfamily SPOC domain-like 3.02e-49
Family SPOC domain 0.00033
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000801
Family Canonical RBD 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000011513   Gene: ENSSARG00000012755   Transcript: ENSSART00000012749
Sequence length 448
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_872:390275:391621:1 gene:ENSSARG00000012755 transcript:ENSSART00000012749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQY
QPSPLPVHYELLPDGYNRHRNLDADLRVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRR
NSLEGYSRSARSRSGERWGDGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGGG
QQADRASDRTPERSRKENHSGEGTKECSGNSLSNSRHGAEERSHHHHHEVSDSSHGKKAR
ESERNHRTTEADPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEG
DQGVISGLLKDHISGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATSS
GPGTEGIPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLYAFPPCDFS
QQYLQSALRTLGKLEEEHMVIVIVRDTA
Download sequence
Identical sequences ENSSARP00000011513 ENSSARP00000011513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]