SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000011642 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000011642
Domain Number 1 Region: 31-170
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.83e-45
Family Molybdopterin synthase subunit MoaE 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000011642   Gene: ENSSARG00000012879   Transcript: ENSSART00000012889
Sequence length 174
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5025:147671:156727:-1 gene:ENSSARG00000012879 transcript:ENSSART00000012889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLSPPSVEGNNALEPLGKDVSEVEETSKDIIQLTAEKLSVDEVSQLVISPLRGAISLFV
GTTRNNFEGKRVISLEYEAYLPMAENEVRKICADMRQKWPVKHIAVFHRLGLVPVSEASI
IIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEMYEESSSSWKRNKECFWATND
Download sequence
Identical sequences ENSSARP00000011642 ENSSARP00000011642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]