SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000012732 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000012732
Domain Number 1 Region: 624-718
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000377
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 877-908
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000401
Family cAMP-binding domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000012732   Gene: ENSSARG00000014076   Transcript: ENSSART00000014081
Sequence length 1091
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_2216:11437:44008:-1 gene:ENSSARG00000014076 transcript:ENSSART00000014081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWAPKEGHTPDMLCGQGADYMVDTAYFPVLIFAILAVGGFLKAYLRNSEVLVLCLLSLAG
LAIGQLAQNVIEVHQVIYPLLLSPSFSLFCYFAPLIIFLAALDVDFHFLRNVLWQVLLVG
LISFLTAFTILFVVVIKYNKELWDTQSSILFSMVLSITDPMLSVKSLKNIGISKTHMDII
SGESLVMCGLATILFGNFRSNIPNLSMLRESHVIISLFLSVLGSIMCGVWALKVIEFVLM
HHFSNTLTTIVLCFSMVYMTFYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFEKQCSNGILGQEAGRILIGATK
TYCTNKGSFMSIYDVSTYVRKKSWVMKFKKYLILLEYEKEKPPLHLYGKNKLMILIYRIL
FSEDFEYAEHAMRLIYIYPLAVHMWPKTRELSVRALIVVNYYFVTLFVAESVLKIIILQK
KYFQNYWNIVEFAIMLLCVLDLFCVYFVTLRPGNWALIQLTVILGYMRFLRLIPLIKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRAKIVYYEYGDTICKEGEMPQGI
YLIISGLAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLSFEKCVQQN
HAYVETLSSYNEMVIDNLSLKLVIIVYGSAVDTKTGAHYLAPCILPKTCQQVQGTSDVNK
FLMIQASKPQR
Download sequence
Identical sequences ENSSARP00000012732 ENSSARP00000012732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]