SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21232636|ref|NP_638553.1| from Xanthomonas campestris pv. campestris str. ATCC 33913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21232636|ref|NP_638553.1|
Domain Number 1 Region: 200-244,277-517
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.67e-40
Family CoA transferase alpha subunit-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21232636|ref|NP_638553.1|
Sequence length 625
Comment hypothetical protein XCC3207 [Xanthomonas campestris pv. campestris str. ATCC 33913]
Sequence
MGAPLGIGKPHRLLNALYAHVVDQPSRPLALYTALSLNPPKPGSGLAARFAGPFISRHFG
DDFPRLAYVDAMLRDALPAHVQVEEFYMQSGGLLHSTQAQADYTSLNYTHAAAAVAQRAP
NLIVQKVAREPGGTRLSLSCNNDITQDTLDAVAALGLPRPLLVAEVDAELPWIGGTAAVD
ASFFDLVLEIPGPSPRLFGLPRQPVTSIDYAIGLYASTLVRDGGTLQIGIGTLADALSHA
LVLRHTDNATYRRVLQALDPTLTSHPSVQASGGLEPFTIGLYGCSEMLNEGFKQLVDSGV
IRRKVHDDLGLMQRLADGTADAADAARLADEGEFLHGAFYLGSPAFYAWLRALDPQLRGA
IGMRRISEINQLYGGNEALERLQRRDARFFNSCMMATALGAAVSDGLEDGRVVSGVGGQY
NFVAMAHALPQARSVLMLRATRASGKDAASNVRWNYGHTTIPRHLRDLYITEYGIADLRH
KTDQDCVLEMAGICDARFQTALLAQARQSRKLRDVPEQAARAQRNTPQALEAALAPFRRD
GSLPDYPLGSDFTDTEQRLLPALGWLKSATTGKTAALATLMRALLSRAAGDAACLQRMDL
ATPRSLGDRVQAKLLAYALQQTRQQ
Download sequence
Identical sequences A0A0H2X4V8 Q8P5X6
gi|66767249|ref|YP_242011.1| NP_638553.1.47755 WP_011038313.1.1732 WP_011038313.1.18295 WP_011038313.1.27778 WP_011038313.1.36111 WP_011038313.1.475 gi|21232636|ref|NP_638553.1| 190485.XCC3207 314565.XC_0917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]