SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383453160|ref|YP_005367149.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383453160|ref|YP_005367149.1|
Domain Number 1 Region: 277-561,638-669
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.04e-92
Family Type II chitinase 0.000000641
Further Details:      
 
Domain Number 2 Region: 561-637
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000055
Family Chitinase insertion domain 0.00098
Further Details:      
 
Domain Number 3 Region: 43-85
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000000916
Family Carbohydrate binding domain 0.00096
Further Details:      
 
Weak hits

Sequence:  gi|383453160|ref|YP_005367149.1|
Domain Number - Region: 106-182
Classification Level Classification E-value
Superfamily E set domains 0.00588
Family E-set domains of sugar-utilizing enzymes 0.045
Further Details:      
 
Domain Number - Region: 205-274
Classification Level Classification E-value
Superfamily E set domains 0.0364
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383453160|ref|YP_005367149.1|
Sequence length 679
Comment chitinase [Corallococcus coralloides DSM 2259]
Sequence
MRRSKWIVGLVASALTVAGCGQESFAPEAEGPGSVMKAPLDAAWAAGVAYSVGTRVTFEG
RVYQCRQAHTSQADWTPTAVAALWLDLGPVTGGGDTTAPVVTASSSSTNITAAGSITISG
SATDNVGVTKIEILENGALVATASSYTRSFSGSGQNGTYTYTVKAYDAAGNVGSKTVTVT
VAIPSNGDVTAPVVTASASASRITAAGSFTVSGSATDNVGVTKIEILENGTLVATASSFT
RAISTSAQNGTYTYTVKAYDAAGNVGTKTVSVVVELPTTPPPPGGKRIVGYFTAWGIYAR
NYQVSNVPASKLTHINYAFSNISPDGKCILGDSFADIDKGFGFPGEWDPGALRGNFRAFK
ELKKTNPNLKLLISIGGWSWSKYFSQVAATAASRTAFVKSCVDLYVKGQFPGVTPANGVG
VFDGIDVDWEYPTGGGLPDNISSPADKVNYTLLMQEFRTQLAAVTAQTGQPYLLTIASGA
SPDLLANKQETVKLAGILDWINVMSYDYHGAFESTVNFHSALDRVTGDPGANDGFYTDGS
IAKMLQLGVPASKIVVGVPFYGRGWGNVPNVNNGLFQSGVPTKGTWDDGQSGLTGVFDYK
DLKANYERAGSGYTKFFHPESKQAYVYSPSTKIWVAYDDVQSINAKSDYILSKGLGGAMF
WELSGDDGSLVNALHTKLH
Download sequence
Identical sequences H8MPB1
WP_014393994.1.7229 gi|383453160|ref|YP_005367149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]