SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383454227|ref|YP_005368216.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383454227|ref|YP_005368216.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.14e-17
Family Frataxin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383454227|ref|YP_005368216.1|
Sequence length 110
Comment frataxin family protein [Corallococcus coralloides DSM 2259]
Sequence
MMDEARYHSLVAAAFKRILAAADTFDPDVLEAEATGDKVTLTAASGEKCIINTQRAVWQI
WVAGQGQGIHFSHDDATRAWKDDKGKGLELFAFVSDVVRHLTGEPLVYPS
Download sequence
Identical sequences H8MLN0
WP_014395058.1.7229 gi|383454227|ref|YP_005368216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]